PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676727908
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family MYB
Protein Properties Length: 533aa    MW: 58860.9 Da    PI: 5.9987
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676727908genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-154390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+++vk++G g+W+++ ++  + R++k+c++rw ++l
        676727908 43 KGPWTSTEDGILINYVKKHGEGNWNAVQKHTSLARCGKSCRLRWANHL 90
                     79******************************************9986 PP

2Myb_DNA-binding49.97.4e-1696139146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v+ +++ G++ W+  a++++ gRt++++k++w++
        676727908  96 KGAFSQEEEQLIVEMHAKVGNK-WAQMAEHLP-GRTDNEIKNYWNT 139
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016938.4E-2601533IPR016310Transcription factor, GAMYB
PROSITE profilePS5129415.4123890IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-234193IPR009057Homeodomain-like
SMARTSM007171.8E-114292IPR001005SANT/Myb domain
SuperFamilySSF466896.11E-2942137IPR009057Homeodomain-like
CDDcd001678.06E-104590No hitNo description
PfamPF139217.7E-1546106No hitNo description
PROSITE profilePS5129425.58291145IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2494144IPR009057Homeodomain-like
SMARTSM007172.7E-1695143IPR001005SANT/Myb domain
CDDcd001671.03E-1198139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MSYTTTTAES DDGLHSSIYN DSPAADKIAY GCRSRGKASF LKKGPWTSTE DGILINYVKK  60
HGEGNWNAVQ KHTSLARCGK SCRLRWANHL RPNLKKGAFS QEEEQLIVEM HAKVGNKWAQ  120
MAEHLPGRTD NEIKNYWNTR IKRRQRAGLP LYPPEIHVED PQWSQEYITS KITGVDRRRH  180
QDFLQLGNSR ADFLFDDLNF ATSFLPGASD VSDMLACNML GTGASSSPYE SYMPPILPSP  240
KQLRESGWFP MCSSNIKQEF QAPEHFQNAG PQKNLRSCSV SPCDVGHPPS ENQHPSDAVI  300
PDSHTFTDGM LPTSKPLFGA VKLELPSFQY SETSSFDQWK TTPSPPHSDL LDSVDTYIQS  360
PPPLEIDESN CFSSCDTGLL DMLLHEAKIK TSAKHSLLLS SPQKSFGSTQ IKSGEFEDYQ  420
KNLDPPEIPI PTQLSADGIS SGKVVKTEEL GQVWEPKRVD ITRPDVLLAS SWLDQQGCFG  480
IVRDSSSMSD ALALLLGGED TGNSYVTVGS SSGQAPRGVG SCAWTNMPPV WSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-32411445107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195850.0AY519585.1 Arabidopsis thaliana MYB transcription factor (At3g11440) mRNA, complete cds.
GenBankBT0039400.0BT003940.1 Arabidopsis thaliana clone RAFL15-06-P04 (R20731) putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
GenBankBT0051200.0BT005120.1 Arabidopsis thaliana clone U20731 putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882732.10.0hypothetical protein ARALYDRAFT_478481
TrEMBLD7LAN10.0D7LAN1_ARALL; Transcription factor
STRINGfgenesh2_kg.3__1182__AT3G11440.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65